SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPBC1198_13c.1 from Schizosaccharomyces pombe 972h-

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPBC1198_13c.1
Domain Number 1 Region: 17-124
Classification Level Classification E-value
Superfamily Rap30/74 interaction domains 7.59e-26
Family Rap30/74 interaction domains 0.0027
Further Details:      
 
Domain Number 2 Region: 189-254
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 1.2e-22
Family DNA-binding domain from rap30 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SPBC1198_13c.1
Sequence length 307
Comment | SPBC1198_13c | Schizosaccharomyces pombe 972h- transcription factor TFIIF complex beta subunit Tfg2 (predicted) (308 aa)
Sequence
MSEEKPTVRTEEDDRYEDDAGDLDLGQIGSRVWLVKIPKFLMDKWNSIPEDDAANLGCVR
VKNDEIQLLLQNSPENADVPKIYNLRVMNKFVRNSYVFRESETSSSMKSTALVGTVAHEC
NVSPVINDDYRRVMQKRALAASAPKRKVQMIDDRGGSLLAPGTLGSRSRSTTSFIRNVKP
RTGEGLKNSRIPRNELLDILFKCFEDYEYWTLKGLREYVKQPEVYLKEVLDSIAILNKRG
PYALKYSLKPEYKGTMDAASVELRNQQASQSESSSIDHTGKNTSPDNPGTNAEEDEDDDG
VEMIDVV
Download sequence
Identical sequences O94424
4896.SPBC1198.13c-1 SPBC1198_13c.1 NP_595082.1.19918 SPBC1198.13c

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]