SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPBC21B10_13c.1 from Schizosaccharomyces pombe 972h-

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPBC21B10_13c.1
Domain Number 1 Region: 30-93
Classification Level Classification E-value
Superfamily Homeodomain-like 0.00000000000000471
Family Homeodomain 0.0055
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) SPBC21B10_13c.1
Sequence length 201
Comment | SPBC21B10_13c | Schizosaccharomyces pombe 972h- transcription factor, homeobox type (predicted) (202 aa)
Sequence
MSLSDSPSKSGNTGKDLISNNEAKNHEDEETHQKKRRRRTTDAEATLLEQYFLKTPKPSL
IERQELSKKLKSSMTPRELQIWFQNKRQSLRRSNCLSRNRLEGTGENSLLRRKSTLTLCE
TSTGQAELFFQSWPLHSQSVVGEMIHHEQDDYNKENKQQKVVDTTKDISRGSNGNEDSAA
HQELEECARSLVELQQQCNDH
Download sequence
Identical sequences P40923
SPBC21B10_13c.1 NP_595674.1.19918 SPBC21B10.13c 4896.SPBC21B10.13c-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]