SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPBC2A9_09.1 from Schizosaccharomyces pombe 972h-

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPBC2A9_09.1
Domain Number 1 Region: 6-201
Classification Level Classification E-value
Superfamily Thioredoxin-like 2.24e-46
Family Phosducin 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPBC2A9_09.1
Sequence length 233
Comment | SPBC2A9_09 | Schizosaccharomyces pombe 972h- phosducin family protein (234 aa)
Sequence
MNPDEDTEWNDILRSKGILPEKEPDVDDVLDDALVDAKQLAHENRLENKDLDELAELEDE
EDDEFLQMYRNKRMQEWKDQMSKAKFGSVYPISKPEYTAEVTDASKEVFVVVHMFQDSLP
ACKLLAAILERLAPMYPQIKFVKIPGKQAVENYPEAMMPTLLIYGHGDLQQQILTLATLG
GMNTSVVDVAEALVRAGALKDSDIAALKDPQNAEDELGKRDSSVNDDLDDDFD
Download sequence
Identical sequences Q9Y7L1
4896.SPBC2A9.09-1 NP_596219.1.19918 SPBC2A9_09.1 SPBC2A9.09

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]