SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPBC3D6_13c.1 from Schizosaccharomyces pombe 972h-

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPBC3D6_13c.1
Domain Number 1 Region: 30-136
Classification Level Classification E-value
Superfamily Thioredoxin-like 3.64e-19
Family Thioltransferase 0.064
Further Details:      
 
Domain Number 2 Region: 289-383
Classification Level Classification E-value
Superfamily Thioredoxin-like 1.89e-17
Family PDI-like 0.092
Further Details:      
 
Domain Number 3 Region: 399-499
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.00000534
Family Thioltransferase 0.079
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SPBC3D6_13c.1
Sequence length 726
Comment | SPBC3D6_13c | Schizosaccharomyces pombe 972h- protein disulfide isomerase (predicted) (727 aa)
Sequence
MRSNTFGSVMRISWVVAFITMVQTLVSGVPLTDNDLESEVSKGTWFIKYYLPSCGACKRL
GPMWDNMVEKAKEQVEGSNFHFGEVDCSKELSSCANIRAVPTLYLYQNGEIVEEVPFGAS
TSEASLLDFVETHLNPDTDPDIPSDEDVLTDEDTEEVASIQPALSTSVSSLSLASTAMSK
SASASEFSGSSVTKASKKLTSSPTSVASKKATLSSVSKVASTSSLPVTSVSASVDPKSAA
SKVQDAEFSIQTAPSFPKEKEEKENTEETEESKKSINPTGTSKALALDADIDAALTDKEG
WFIQFYSSECDDCDDVSTAWYAMANRMRGKLNVAHINCAVSKRACKQYSIQYFPTFLFFK
EEAFVEYVGLPNEGDLVSFAEEAANFEIREVELLDTVNAEKNGDVFFLYFYDDDSAEYLN
IIRKTGIQLLGHANLYLTTSQQIAKKYRVVSFPKLIVVRDGIASYYPAKMAQDNKDYRRI
LGWMKNNWLPVLPELRTSNSKEIFNDESVVLFLLNPELDDFDETKRTAQKIATEFLDEEG
RTYQSNWQKETDKKNSLVNEAEEKNDLEAIEAAKNFHVNGKPSPTRFAWVNGKFWAQWLR
KFDIDIEATGPRVIVYNAAQDIYWDETAKGTPISIEKDTVFDIIKQVETDPDHLKFKILK
KNLGVEYLESYGLNIRVLYMVLGIVTVGILVWYFSGRRARTLQRRRHSTPILPVSMRSTG
NSGKFD
Download sequence
Identical sequences D0EJL8 P87178
SPBC3D6.13c SPBC3D6_13c.1 NP_595525.1.19918 4896.SPBC3D6.13c-1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]