SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPCC1840_08c.1 from Schizosaccharomyces pombe 972h-

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPCC1840_08c.1
Domain Number 1 Region: 121-200
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.0000000612
Family Thioltransferase 0.087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) SPCC1840_08c.1
Sequence length 561
Comment | SPCC1840_08c | Schizosaccharomyces pombe 972h- protein disulfide isomerase (predicted) (562 aa)
Sequence
MELGAWRSILYIAFLFAITRHAFCKAVNLVHSPEGEEFENILSSVSATVEKKEVNNKLIM
PTANRDNQGVREELLVSSFKERKLLNTNSANLRLNSIGSYEMIDFKQINSEFFLSHRQHG
FVLFIDSKKKPRQSFYTDSATSIVQLSKKYRNKIKFKSVDCASSLEKCEEIGINSFPSLV
YYNNAGQKKVFTAHTPYEVLSKHADLITELDETDGKVYPQSIIRLEEFKNLKANEPVFFL
YLHDYGSTPEDFDSLRIFARYLVGFAPLYRTDDEKVIKTLNVTRLPHLVAIRHGVAFSYS
ERSVSAMRNTFQLIKWASLLKYPLVPELTPAVVENLDSDSYLAIALINPTSQVKASKAIS
TVQEIGLKWTLKLREVERKQLLTAREKWWDHLRMLKQKGYDDVAFLAAEYSLPLPKNKKV
TFVWVNSLQWKTWISHTFHIDPMGPSRFVLMDPSRMFYWDSSAKGLPLTLDDSSLILDTT
FRVLAITGEGLPHEFSIPRGYVYLSEIKQYSSLILISLWISLILFVSFLNRRLILHYSFE
SVHQLKTLTRKFIYSSLLKQD
Download sequence
Identical sequences O74481
4896.SPCC1840.08c-1 SPCC1840.08c NP_588507.1.19918 SPCC1840_08c.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]