SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for SPCC777_12c.1 from Schizosaccharomyces pombe 972h-

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  SPCC777_12c.1
Domain Number 1 Region: 47-141
Classification Level Classification E-value
Superfamily Thioredoxin-like 0.000000000267
Family Thioltransferase 0.046
Further Details:      
 
Weak hits

Sequence:  SPCC777_12c.1
Domain Number - Region: 134-170
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0167
Family N-acetyl transferase, NAT 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) SPCC777_12c.1
Sequence length 238
Comment | SPCC777_12c | Schizosaccharomyces pombe 972h- sequence orphan (239 aa)
Sequence
MKINLFFVFLFELLHFVAAYSCEGDESAAIEAMNVLQVPYEKYNTDPVCAFDNSTVVELS
DKTWDHVIESGKWFVQLTAEGCANCTLGELLFNDLSHAFHEKYPDVHFARVYLSSSLELS
VRLLISRIPSYYFIDNQNFYRVSPQVLPKNKAIALYEKDGFKSMKKEQGFFSVNGPLKSF
YWVFGKALALYGHLSQKYTPLGMNVAIFGISAYIMYRSSKKAKQKQAAAAAAAAAKKK
Download sequence
Identical sequences O74551
SPCC777.12c SPCC777_12c.1 4896.SPCC777.12c-1 NP_588258.1.19918

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]