SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|188586850|ref|YP_001918395.1| from Natranaerobius thermophilus JW/NM-WN-LF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188586850|ref|YP_001918395.1|
Domain Number 1 Region: 97-225
Classification Level Classification E-value
Superfamily GntR ligand-binding domain-like 4.71e-24
Family GntR ligand-binding domain-like 0.0086
Further Details:      
 
Domain Number 2 Region: 9-81
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 6.47e-22
Family GntR-like transcriptional regulators 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|188586850|ref|YP_001918395.1|
Sequence length 227
Comment GntR family transcriptional regulator [Natranaerobius thermophilus JW/NM-WN-LF]
Sequence
MEDWNIKKLKTTSLSDRVIDQIIDLIVQGKLKPGNKLPSERELVELFGVSRSSIREALKT
LEKINLLKSVPGRGVYLSSEEDEGSVSALAYPLLLTNDIEELFEARELIQVEMARKAAKR
ATEEDIKNIREVIRKASQAETKSEKAELDVEFDLNLAKAARNSVLLKFLISIQEVLRLTQ
LKFITEERYTKSINDHTKIVDFVEKGKPEEAAEAMRVHLISVKDDIN
Download sequence
Identical sequences B2A839
gi|188586850|ref|YP_001918395.1| WP_012448659.1.10671 457570.Nther_2241

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]