SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|188586101|ref|YP_001917646.1| from Natranaerobius thermophilus JW/NM-WN-LF

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188586101|ref|YP_001917646.1|
Domain Number 1 Region: 281-438
Classification Level Classification E-value
Superfamily HD-domain/PDEase-like 3.37e-31
Family HD domain 0.018
Further Details:      
 
Domain Number 2 Region: 175-271
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 2.28e-17
Family Eukaryotic type KH-domain (KH-domain type I) 0.0024
Further Details:      
 
Weak hits

Sequence:  gi|188586101|ref|YP_001917646.1|
Domain Number - Region: 21-108
Classification Level Classification E-value
Superfamily Bacterial hemolysins 0.00118
Family HBL-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|188586101|ref|YP_001917646.1|
Sequence length 487
Comment metal dependent phosphohydrolase [Natranaerobius thermophilus JW/NM-WN-LF]
Sequence
MIAEAKITSAEEAADKIIEDAKKQGESMKREALLEAKEEIHTQRNELEKETRERRNEIQR
FERKLEQKEESLSKQQKQLEQKEKEIAQKDEKITNKEQELEKIYQQQVEELENLSGLTTQ
EAKDMLLNRVREDISHETAMMIKEMESRAKEEADKKAREIITTAIQRCAVDHVAESTVSV
VSLPNDEMKGRIIGREGRNIRTLETLTGIDLIIDDTPEAVILSGFDPIRREIARLALEKL
VSDGRIHPARIEEMVEKAQKEVDEQIREEGEQATLDTGVHGLHSELIKLLGRLKFRTSYG
QNVLNHSIEVARLCGVMAHELGTDVNTAKRAGLLHDIGKAVDHEYEGPHVTIGAELGKKY
GESSNVLHAIATHHGDEEPETIEAVLVQAADAISAARPGARRETLESYIKRLEKLEEIAD
SYKSVEKAYAIQAGREVRIMVKPEQADDETSINLARDISKQIEAELDYPGQIKITVIRET
RAVEYAK
Download sequence
Identical sequences B2A3V6
gi|188586101|ref|YP_001917646.1| 457570.Nther_1475

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]