SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for BDBG_01526T0 from Ajellomyces dermatitidis SLH14081

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BDBG_01526T0
Domain Number 1 Region: 367-442
Classification Level Classification E-value
Superfamily Ubiquitin-like 0.000000000723
Family Ras-binding domain, RBD 0.025
Further Details:      
 
Domain Number 2 Region: 475-575
Classification Level Classification E-value
Superfamily PH domain-like 0.00000103
Family Pleckstrin-homology domain (PH domain) 0.033
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) BDBG_01526T0
Sequence length 938
Comment | BDBG_01526 | Blastomyces dermatitidis SLH14081 conserved hypothetical protein (939 aa)
Sequence
MDARPHTSSSSTTSPVLTQPPPLQAPPKFSRYRSVRKAAEAQAIQNAAAQSFPTPLSPPP
LPMSSEIGSPPPFSKTQNESIKRSMSRYRHAKPSATKTAYPVPSPSPLPAAVTLPTRPHT
DGDCMQDLQAREQHEITPKQQGAGSTRLQDHSDTAPASDASCSQGAVQSTSQSHDTKGSH
GAGPIDNIAEDTKPPTGYFSLERHSSMSSMEDSRPRRSRTHTDPGRANVRSPTSESHNTP
AVPGRLRTVPEPRMLDIRDHVQNITNEELAANERAAAAHNGLKSKPQLVKVKGGGFLSRM
KALDPTSSSKPNNNSSGGNSHHNNNRERLKTLISSPLPISPDEVKVASGNEAPISAVNAG
ERKVLVICNDSFICLPFTPTTQAQDLLNSAANCLSENIEPQSSILLESFKQLGLERPLRK
YEHVRDVMNSWDSDSQNHLMVSRLPDQREREGLDVRLAPRKQPSESIFHLYHSQRPGKWE
RRWVTLRSDGQVTIAKKQGGESMNICHLSDFDVYSPTSLETVRRVKAPKRICFAVKSQQK
SSMFLTTENFVHYFATDDEQIGLGWYKAVQQWRSWYLVNVLGEGDKEEDSINSDAKSPQS
GAQKSRSRQGSDASIPYQLGTFKPLLDMDISKWKIEPIDNIPEEVSKEPSISKAASVHGR
PTRPQKRPSTPAKKSKKEPTTESDPDPFVSSGLLGKTYAQRTKALEEREKDASQQAFTGL
GLLRNLATESPTSPSDRSSRRNSRDYTSPQIPTSPKDSINGGPFSRSKSVKQKPKPLIDL
TPVFQEPPQHTRKGRGVAAEHGQPLVEAATSPEVPPGAILTAAATTTSPSRHCPSQPRDN
ATRKPPIQTPIQISSPHALTHTSPFAPTGLLARAATTAAGPPGRYDTGRGVATGDRNNFA
KPMVDLSQESQFVEGSLLRGVEAGEVVVGKGPVAGDRK
Download sequence
Identical sequences BDBG_01526T0 XP_002628618.1.14838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]