SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for BDBG_03620T0 from Ajellomyces dermatitidis SLH14081

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BDBG_03620T0
Domain Number 1 Region: 1189-1316
Classification Level Classification E-value
Superfamily PH domain-like 4e-20
Family Ran-binding domain 0.0075
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) BDBG_03620T0
Sequence length 1317
Comment | BDBG_03620 | Blastomyces dermatitidis SLH14081 conserved hypothetical protein (1318 aa)
Sequence
MSKRAAQVQGGKELAGGFGNEMSANSADTPKRATAAQLASRNQSVYLPLRGHPFTPIWSA
FLPPFQSKGYDQSARELKALSESAKFSKMLSLLPHMLRLAYPFSAIDPNIVPPTSSTPTN
GFSFGQAQSFPQTGPGTSTTTTPQSSFFGDQNNSGPKVFGSQAGSAPSSFSFTPSTTQEI
KNPFASMSSGFGQSQGSTGGFQGFQGNTFNIPGTATNQDAQNKAGQQAPTGGMFGSSQPP
QQTPFTFGATSAPKSASLFSAAPPVSTPTSTSAPIFGQSTGGTIFGASTPSTPSTPSTNI
FGASSQANKPSDEMQMSPPAKSNGTGENRANQFSISQPSFTSSTTQPSIFETSAFKPAAP
ATSSTSQPFSSIFITTPSSGTTLFGAMKKPDETPKPTSSSTAPATFSFTPSTAPGSSIFG
QASKPEDQAATAITTTSSGASFSTSFPVPAPAPAPFSLFGTTAKPKEPSSAPSATEDKVS
STKSAVPEPPTTPGASLFGQIAKPPEEPQASSTPTPEAEKLPTESPSIAPAATPSASPFP
STPSGGTSLFGRASKPAETIQPTSIFNTPATSTTPSAPTFSFTPSSTSIFQTPKSALATS
DGEKTKEAAQSATGLFQTKAATDTTPSGTSKPFTSLSQAQQPPSSLFGSTPSPSLFKTSA
GPEKAPSTPQASSTSPPEKFTPKPLFSEISNGVAGTTKAMDTSPTKAPAPLKRKEPLVPK
SRLASYGPPAIPRELNNDERAEFDTEWRLNALNASFQKRVAEADPKSDDIDVLVEFYVRL
RENIGVPMGLAVVPKTGKKRKAVEEDGHVAEDFSHNKRTKGLPTFTSQHKTDAASVSSSP
AAVGGSSLFGEKSTSASANFSSTASPSGKRKMTCIEDDASSRSEPGNVSGKRRKSTGEST
AGASPLQKSSTNSEKKKGNNGHTSSGSGVSAASDTVTMFATSFVSQSQRGNSPVRFTAPF
SSLSSTQDSAEGTAASSGSLQGSESENDTESNASAGEDDGEGEEEEGESESSATPPPTTN
GGRSLFDRVELDQSGKPVRQDVLEAEDKVAIPSPGEKDSNSAVSSLFAGSKFASSFNSPA
SIGTPQFSNGFDFKSPGALSPTNASPEASDANSPPVILASSAGTSTPTAPVASATTSSLF
SKATSSLLPNGSAQLSPFPLSAGTSADVSRATTPNLSEAGAEEPEESTEELPQVDLLRGG
TGEEDEDEVFEARAKTLKLGVPPDADDETPKWLLQGVGLLRILKNKTTGRSRILVRADPS
GRVLLNTNLVAAINYKSVGSAVRFLVPREPKPENWIAMVKKEDIAVELAKVMEKYKT
Download sequence
Identical sequences XP_002626456.1.14838 BDBG_03620T0

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]