SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for BDBG_07134T0 from Ajellomyces dermatitidis SLH14081

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  BDBG_07134T0
Domain Number 1 Region: 613-657,697-778
Classification Level Classification E-value
Superfamily PH domain-like 2.95e-27
Family Ran-binding domain 0.0061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) BDBG_07134T0
Sequence length 779
Comment | BDBG_07134 | Blastomyces dermatitidis SLH14081 conserved hypothetical protein (780 aa)
Sequence
MASETHQENGVLNDEPASRTPSAAIFPEPHSTALDTAEHTDKDSQGPVSGMQEQNPVSPR
ETQEKRDLASLPESDNPEGSNTDDVGAAPGARPTPQQGTRENTPPSNSGQDQDGEARHIE
LQDAQDQKMEKKVAHKTNVKKSLSDADEGSTHLKQENHEPTPENDVAELSEGTNVQEPEK
DKISHPSSDKQKDGAGERPVRQKLKETSIAGVPRPNSPEDHAMASQVASVAGADSVNETS
SVEARGRLWRKRSRGDMNEDENQDDISGVTNTDETGHRRKRSRDSKTDDQSSDNQGQPKS
KLTAGDKQDITDSMDTKPLADEGGIRTPTEELKSTERDAANRILSPKKKRSRDQFDKDHL
KSDALDEKCQEGAASAKTGESFDRPKAVSANRTVEGEPEKKRHRDDSQDRSSQGDSDLVS
KKASAPNPFSNTLGVSPFASMSSKPTQLTSKGTTEKKEQPMTSASAFASSKLASFASSEK
SPFSSLGGGSTIGLKSASPTKNTTVNKPPQTSSSAFTASPFAAAAASSPFGAFGGGKSAF
SRSGFGTGFSAATPKLGGGLAGFAASTTGGSAILGAAGSKHGDEKNVEKGRKGGDDGKST
FEGLEEEKGDERFHEQQTETGEEGEDTIFSCRGKLYHFDGKEWKERGVGVFKVNIREPAN
GDDDTDESSEEQQPLEDKVEEKEEKEEVKAKTDEDDNNEPKKKTARVIMRADGVWRVILN
IPIFKGMKAGDPSGAAPKGKQVHFAGFEEGKSVPFLFRTGNEDVAKELCVTIQKLQESL
Download sequence
Identical sequences BDBG_07134T0 XP_002622623.1.14838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]