SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|414073255|ref|YP_006998475.1| from Lactococcus lactis subsp. cremoris UC509.9

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|414073255|ref|YP_006998475.1|
Domain Number 1 Region: 16-220
Classification Level Classification E-value
Superfamily CAC2185-like 1.16e-56
Family CAC2185-like 0.00086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|414073255|ref|YP_006998475.1|
Sequence length 222
Comment acetyltransferase [Lactococcus lactis subsp. cremoris UC509.9]
Sequence
MDIYSPIIARYKTFLCHKLSNYRRNYRRKKLNKTRFTIISNNCWGGGIYERYNLVKQSPT
IGLYILPGDYLKFISNIKHYLHCKLEFIDPNCSENKEYIINNLDPNYGSYPVGVLDDIEI
YFLHYKNRESAKSKWKRRIDRICWDHIIFKFNDQNGCTNEQLIQFAKLPLPNKIAFTVRD
GFEDFDSIIKVNNPNKKDYVEYLNEPFGQNKYFNVNKFINRI
Download sequence
Identical sequences gi|414073255|ref|YP_006998475.1|NC_019430 gi|414073255|ref|YP_006998475.1| WP_015081766.1.37992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]