SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|188589186|ref|YP_001920505.1| from Clostridium botulinum E3 str. Alaska E43

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|188589186|ref|YP_001920505.1|
Domain Number 1 Region: 1-474
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 5.24e-155
Family SCOPe 0.024
Further Details:      
 
Domain Number 2 Region: 465-795
Classification Level Classification E-value
Superfamily Clostridium neurotoxins, "coiled-coil" domain 6.81e-118
Family Clostridium neurotoxins, "coiled-coil" domain 0.00053
Further Details:      
 
Domain Number 3 Region: 804-988
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 8.86e-37
Family Clostridium neurotoxins, the second last domain 0.038
Further Details:      
 
Domain Number 4 Region: 806-1032,1090-1120
Classification Level Classification E-value
Superfamily PDB 0.00000000312
Family PDB 0.000000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|188589186|ref|YP_001920505.1|
Sequence length 1163
Comment botulinum neurotoxin type E3, nontoxic-nonhemagglutinin component, NTNH [Clostridium botulinum E3 str. Alaska E43]
Sequence
MKINGNLNIDSPVDNKNVAIVRSRKSDVFFKAFQVAPNIWIVPERYYGESLKINEDQKFD
GGIYDSNFLSTNNEKDDFLQATIKLLQRINNNVVGAKLLSLISTAIPFPYENNTEDYRQT
NYLSSKNNEHYYTANLVIFGPGSNIIKNNVIYYKKEYAESGMGTMLEIWFQPFLTHKYDE
FYVDPALELIKCLIKSLYYLYGIKPNDNLNIPYRLRNEFNSLEYSELDMIDFLISGGIDY
KLLNTNPYWFIDKYFIDTSKNFEKYKNDYEIKIKNNNYIANSIKLYLEQKFKINVKDIWE
LNLSYFSKEFQIMMPERYNNALNHYYRKEYYVIDYFKNYNINGFKNGQIKTKLPLSKYNK
EIINKPELIVNLINQNNTVLMKSNIYGDGLKGTVDNFYSNYIIPYNLNYEHSINYSYLDN
VNIEEIEKIPPINDEDIYPYRKNADTFIPVYNITKAKEINTTTPLPVNYLQAQMIDSNDI
NLSSDFLKVISSKGSLVYSFLNNTMDYLEFIKYDKPIDTDKKYYKWLKAIFRNYSLDITE
TQEISNQFGDTKIIPWIGRALNILNTNNSFVEEFKNLGPISLINKKENITIPKIKIDEIP
SSMLNFSFKDLSENLFNIYCKNNFYLKKIYYNFLDQWWTQYYSQYFDLICMASKSVLAQE
KLIKKLIQKQLRYLMENSNISSTNLILINLTTTNTLRDISNQSQIAINNIDKFFNNAAMC
VFENNIYPKFTSFMEQCIKNINKSTKEFILKCTNINETEKSHLIMQNSFSNLDFDFLDIQ
NMKNLFNSYTELLIKEQTSPYELSLYAFQEQDNNVIGDTSGKNTLVEYPKDIGLVYGINN
NAIHLTGANQNIKFTNDYFENGLTNNFSIYFWLRNLKQNTIKSKLIGSKEDNCGWEIYFE
NDGLVFNIIDSNGNEKNIYLSNISNNSWHYIVISINRLKDQLLIFIDNILVANEDIKEIL
NIYSSDIISLLSDNNNVYIEGLSVLNKTINSNEILTDYFSDLNNSYIRNFDEEILQYNRT
YELFNYVFPEIAINKIEQNNNIYLSINNENNLNFKPLKFKLLNTNPNKQYVQKWDEVIFS
VLDGTEKYLDISTTNNRIQLVDNKNNAQIFIINNDIFISNCLTLTYNNVNVYLSIKNQDY
NWVICDLNHDIPKKSYLWILKNI
Download sequence
Identical sequences A0A0C2NX85 A0A0X1KH90 A8Y872
508767.CLH_1111 4zkt_B 4zkt_D 4zkt_F WP_012450714.1.10246 WP_012450714.1.14003 WP_012450714.1.31784 WP_012450714.1.43682 WP_012450714.1.47997 WP_012450714.1.53901 WP_012450714.1.65636 WP_012450714.1.73899 WP_012450714.1.92433 WP_012450714.1.92626 WP_012450714.1.9385 gi|188589186|ref|YP_001920505.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]