SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197122445|ref|YP_002134396.1| from Anaeromyxobacter sp. K

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197122445|ref|YP_002134396.1|
Domain Number 1 Region: 5-218
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.56e-57
Family LplA-like 0.0000124
Further Details:      
 
Domain Number 2 Region: 227-362
Classification Level Classification E-value
Superfamily Nudix 6.91e-27
Family MutT-like 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|197122445|ref|YP_002134396.1|
Sequence length 365
Comment lipoate-protein ligase B [Anaeromyxobacter sp. K]
Sequence
MPRVLRTYRLGRVEYEDGLALMRLAADAVRAGTPAATDFLFLLEHPPVLTLGRSAGREHI
VAAPAWLEKQGFEIHETDRGGDVTYHGPGQIVGYPVLDLNGRKDVRRYVGALEEAMIRTC
ADFGVEAGRHPEHRGCWVGRRKIGAIGVHLSRWITSHGFAFNARTDLAHFQVIVPCGIAD
PRLGVTSLEAELAARGRATPEQAEIENRLAAHLADVLELARADAGPDLRTISVVPVRPDG
RVLLLRRSVERGGFWQQVTGRIEPGEAPEQAARRELREETGADLPVVSLGYRHAFGLDPS
VNRVRPGALVVVEEVAFAARVPDGFEPRLSGEHTEHAWATGEEAAAQLRFPGLRRAVRLA
LSARR
Download sequence
Identical sequences B4UC36 B8J944
447217.AnaeK_2039 455488.A2cp1_2109 gi|220917212|ref|YP_002492516.1| gi|197122445|ref|YP_002134396.1| WP_012526068.1.49349 WP_012526068.1.98204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]