SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|197122471|ref|YP_002134422.1| from Anaeromyxobacter sp. K

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|197122471|ref|YP_002134422.1|
Domain Number 1 Region: 3-127
Classification Level Classification E-value
Superfamily Nudix 4.47e-34
Family MutT-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|197122471|ref|YP_002134422.1|
Sequence length 129
Comment NUDIX hydrolase [Anaeromyxobacter sp. K]
Sequence
MRRKIRVVGAMIEQDARYLITQRPPTASLPLLWEFPGGRVEAGETDPAALARELAEEMGI
GVEVGGRVIHVEHAYEAYDIDFCVYRCRLVRGPIQHIRVHDHRWVRPDELDQYEFPPADE
KSIAKLLGL
Download sequence
Identical sequences B4UC62 B8J991
gi|220917259|ref|YP_002492563.1| 447217.AnaeK_2065 455488.A2cp1_2157 gi|197122471|ref|YP_002134422.1| WP_012526094.1.49349 WP_012526094.1.98204

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]