SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|317051317|ref|YP_004112433.1| from Desulfurispirillum indicum S5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|317051317|ref|YP_004112433.1|
Domain Number 1 Region: 933-1093
Classification Level Classification E-value
Superfamily ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase 3.93e-29
Family Histidine kinase 0.0038
Further Details:      
 
Domain Number 2 Region: 298-404
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 4.01e-29
Family Flavin-binding PAS domain 0.011
Further Details:      
 
Domain Number 3 Region: 400-572
Classification Level Classification E-value
Superfamily GAF domain-like 3.49e-25
Family GAF domain 0.0087
Further Details:      
 
Domain Number 4 Region: 573-695
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.74e-21
Family Heme-binding PAS domain 0.051
Further Details:      
 
Domain Number 5 Region: 721-839
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 6.11e-20
Family Flavin-binding PAS domain 0.085
Further Details:      
 
Domain Number 6 Region: 856-933
Classification Level Classification E-value
Superfamily Homodimeric domain of signal transducing histidine kinase 0.00000000161
Family Homodimeric domain of signal transducing histidine kinase 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|317051317|ref|YP_004112433.1|
Sequence length 1097
Comment PAS sensor protein [Desulfurispirillum indicum S5]
Sequence
MFVPLAGALAVAVVVTLFLLQLASVRTEQRVSQARSEGQERIVQLREQLEDALFDSYHVM
HATAREVAELSPWSEERFAAAGSRVLQAQDAISAIALVSRQELAAVYPPSLAQNVPCFTS
KSIHRLSQNSSTSATLRGPLFPSPDEAQVCMAIPLSATADADAGILLAAINLASMLEKAG
SVDFRLDGMFLGLSKALSPVAEGEFAGHERAFRDDAVTTRLRFHDAEWYFSMAPQGQWGP
QVYSWVWVIALFSVAAGSLSWYLFHQLMRMHRSSQRLVPEMRSRRQAQQEVRRMSRALEN
SACSVLITDIDGLIEYANPKTCRVTGYSQAELLGSNPRLFSAGETPAEVYDAMWSDLLSG
REWVGELLNRRKDGSLYWEHVAISPILNQSGRIMSYIAVKEDITRRRQVEITLERERGVL
EAIAQARPSSEILRTICAIIQEQIPHSRCSFMLLDASGKVLQGCIHTDLPTEYVDLIVSV
PVREASGSCGTAAYRRQPVIVSDIATDPFWSGPFRVMALKHGLNACWSWPVLSSTEEVLG
TFAIYCRDQRRPEPHEELMVMRFASIAAIAVEKEEWREKLLLSEQRYRSFMESLNDGVII
TQDGLLRYLNQSMAQMVGYGRESLTETPFMTYIHPDDQALAMDYHRRRMMGQQAPSEYDV
RLLCHDGRVITVRVNSSLITWNNRPAALATVTDMTRRHEAQEQIRQLNESLERRVTEELK
RRMETETLLEGVFENSSVGIVAIDGRGQVLRANATYCQMLGYCPEELREVGLDSLHPDDR
LTVVEHFESLMDGSAAMCQIEIRYLTRDGGLLDVQIVASALNDENGDPRAILAMVKDISD
LKVAIRRQRIQEQLLIQQSKMAVMGEMIGAITHQWKQPLNALSIILQEAREDYQLGILPP
PVFSEAVERSLNHIDFMSRTIDDFRDFFRPDKSRVLFDIIEAVEEVEKLLQKQLHLHSVS
MLYEISSENQAHRAIYTVANEVKQIVLNILNNAIDAIAAARVQGLLHRNDNGIIRVRLET
TPMERILLIEDNGGGIPDEILPRIFKPYFTTKADKGTGIGLYLSRMIMENSLGGSISVTN
TPSGACFRLAFPTLQKE
Download sequence
Identical sequences E6W4A3
gi|317051317|ref|YP_004112433.1| WP_013505758.1.92402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]