SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|307594495|ref|YP_003900812.1| from Vulcanisaeta distributa DSM 14429

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307594495|ref|YP_003900812.1|
Domain Number 1 Region: 67-123
Classification Level Classification E-value
Superfamily beta-beta-alpha zinc fingers 0.0000894
Family Classic zinc finger, C2H2 0.032
Further Details:      
 
Weak hits

Sequence:  gi|307594495|ref|YP_003900812.1|
Domain Number - Region: 41-63
Classification Level Classification E-value
Superfamily TBP-interacting protein-like 0.000366
Family TBP-interacting protein-like 0.0061
Further Details:      
 
Domain Number - Region: 12-49
Classification Level Classification E-value
Superfamily Rubredoxin-like 0.0186
Family Rubredoxin 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|307594495|ref|YP_003900812.1|
Sequence length 130
Comment zinc finger C2H2-type domain-containing protein [Vulcanisaeta distributa DSM 14429]
Sequence
MSTAAKALTKIVVCPLCDYMGEDVNKVVDAITKASPRPKLKCPKCGAEVDVNSFVTHMRR
HGRVGGKTITCEICNAKLNGEGAFLRHIKEHLIVSVRRNGMDIYYCLVCGQEFITKNSAI
THLIKRHSLE
Download sequence
Identical sequences E1QTP6
gi|307594495|ref|YP_003900812.1| WP_013335486.1.43420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]