SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|307594844|ref|YP_003901161.1| from Vulcanisaeta distributa DSM 14429

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307594844|ref|YP_003901161.1|
Domain Number 1 Region: 1-69,146-333
Classification Level Classification E-value
Superfamily Phosphoenolpyruvate/pyruvate domain 8.37e-73
Family Pyruvate kinase 0.0000186
Further Details:      
 
Domain Number 2 Region: 313-441
Classification Level Classification E-value
Superfamily PK C-terminal domain-like 9.62e-26
Family Pyruvate kinase, C-terminal domain 0.002
Further Details:      
 
Domain Number 3 Region: 65-157
Classification Level Classification E-value
Superfamily PK beta-barrel domain-like 0.0000000000244
Family Pyruvate kinase beta-barrel domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|307594844|ref|YP_003901161.1|
Sequence length 453
Comment pyruvate kinase [Vulcanisaeta distributa DSM 14429]
Sequence
MGKVKIIATIGPSSEKPEVLKELIKYVDGIRINFSHGSAEEWRSRIMNARSLRSDIAVLG
DLRGPGVRTGSMKPITLGVGDSVEFRFADKSDGGFVPIPSPSFFRVITVDDIIVMNDGRL
RLRVDKVSASNAVLTALTAGTISQEKAVVIKGKDYPLPILDDYDREALKFAVEVGMDYVG
ISHVRSSDDIEEVRTELRRLGGDWIKLMAKIEGPDAVRNMKDVICASDYVMVARGDLGMH
FDLEEIPRIQSSIIREAQKCGVPTMVATQLLESMIEQPVPTRAEVVDITNAVMEGVDSLL
LTGETAVGKYPVEAVQWLRRVATEYEDEVHVDRGVMANLTDRLALGIVQLAEDIGAKIVI
YSRGGRFVEAISRYRPRVPTYVGVSDEKVLRRLRLYWGVEPILIDNVRDYDEGERETLNQ
LIRSGLVVKGDLVLLTHGVIDTYNDYSIRILKV
Download sequence
Identical sequences E1QNE0
gi|307594844|ref|YP_003901161.1| WP_013335835.1.43420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]