SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|307595060|ref|YP_003901377.1| from Vulcanisaeta distributa DSM 14429

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307595060|ref|YP_003901377.1|
Domain Number 1 Region: 169-284
Classification Level Classification E-value
Superfamily DNA primase core 0.0000000123
Family DNA primase DnaG catalytic core 0.026
Further Details:      
 
Weak hits

Sequence:  gi|307595060|ref|YP_003901377.1|
Domain Number - Region: 138-182
Classification Level Classification E-value
Superfamily L30e-like 0.0863
Family L30e/L7ae ribosomal proteins 0.085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|307595060|ref|YP_003901377.1|
Sequence length 461
Comment TOPRIM domain-containing protein [Vulcanisaeta distributa DSM 14429]
Sequence
MGALTIVAKYLIVANVEVQGTVEKYDIIGALFSQTEGLLGNELDLRELQMNGRIGRIEVE
TEYKGDKTVGKVYIPSNLDRYETALVAAMIETVDKVGPYNAKVQVVEIKDLREEKRKKIF
DRARELLKLVEHEALPDTKELITKFMESIRETEVIEYGPEKLPAGPEVDTADTIIIVEGR
ADVLNLVKHGFKNVIGLGGSSGGVPKTVVELSKKKTTIAFVDGDRGGEMLLKELLKYADI
DYIARAPPGKEVEQLTAKEITKALRNKVPAEEYLASLEKRERKMIEEARQQAQQEIPQAQ
AIEVPIQEQPQQAEKVQVLPQPQPIQPTPPAMQAQVTPQQTTQPQQLSQPSPEIPQLPPN
VIDEMKKLGGTLEAIIYDDHWTEIKRIPVRDLVDTLQQLPNAYAVIFDGVCTQRLVDVAS
SKGVKLLIMSRVGNITKVPTDMLIMTIDEYLSKAGAGTGAK
Download sequence
Identical sequences E1QPN0
gi|307595060|ref|YP_003901377.1| WP_013336051.1.43420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]