SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|307595646|ref|YP_003901963.1| from Vulcanisaeta distributa DSM 14429

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307595646|ref|YP_003901963.1|
Domain Number 1 Region: 7-75
Classification Level Classification E-value
Superfamily SirA-like 0.0000000000837
Family SirA-like 0.0062
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|307595646|ref|YP_003901963.1|
Sequence length 79
Comment hypothetical protein Vdis_1527 [Vulcanisaeta distributa DSM 14429]
Sequence
MRVGELTVDLRGIGCPYGSTLAIQNFRDAPVGSVITFILDDEECYLTLKRLFPLLGQRVI
KTEEQNKVYKLSVLKVRFF
Download sequence
Identical sequences E1QTB9
WP_013336637.1.43420 gi|307595646|ref|YP_003901963.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]