SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|307595891|ref|YP_003902208.1| from Vulcanisaeta distributa DSM 14429

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307595891|ref|YP_003902208.1|
Domain Number 1 Region: 35-212
Classification Level Classification E-value
Superfamily ADP-ribosylation 4.24e-50
Family Tpt1/KptA 0.0000265
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|307595891|ref|YP_003902208.1|
Sequence length 219
Comment phosphotransferase KptA/Tpt1 [Vulcanisaeta distributa DSM 14429]
Sequence
MRSIYKCVICGSYTEDTVHCGVQARLLLDGKLRSRLSHLMTYLLRHDPSAVNLSMDSEGW
VSIDELVHALRDKWDPKAYSWLTKEHIMAVASLDPKGRFEIRDGMIRARYGHNKSLDVNI
RYEVDSEVRTLYHGTTKRALVRIMREGIKPMNRKYVHLVLDPRDAYEVALRHGNDVVILK
INVDCLRRNDQQILIATDRIRLTDYVPPQCIESVIDPRN
Download sequence
Identical sequences E1QUN8
WP_013336882.1.43420 gi|307595891|ref|YP_003902208.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]