SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|307595900|ref|YP_003902217.1| from Vulcanisaeta distributa DSM 14429

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307595900|ref|YP_003902217.1|
Domain Number 1 Region: 51-124
Classification Level Classification E-value
Superfamily SMAD/FHA domain 6.7e-18
Family FHA domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|307595900|ref|YP_003902217.1|
Sequence length 134
Comment FHA domain-containing protein [Vulcanisaeta distributa DSM 14429]
Sequence
MEHSEETRRMELPNTETVRRGPSKLELTFIESPKDFMKDFKVIFDLSIIREITLGRSPEN
MVIIPDPTVSRKHAVITMVGNELLIKDLNSTNGTYVLDGGTFKRVSEYRFNGDVVVRLGY
YTVIKLSLMTEENA
Download sequence
Identical sequences E1QUP7
gi|307595900|ref|YP_003902217.1| WP_013336891.1.43420

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]