SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|325283425|ref|YP_004255966.1| from Deinococcus proteolyticus MRP

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325283425|ref|YP_004255966.1|
Domain Number 1 Region: 120-146
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000706
Family Type I dockerin domain 0.0071
Further Details:      
 
Weak hits

Sequence:  gi|325283425|ref|YP_004255966.1|
Domain Number - Region: 5-25,86-111
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 0.0392
Family Outer membrane efflux proteins (OEP) 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|325283425|ref|YP_004255966.1|
Sequence length 173
Comment hypothetical protein Deipr_1198 [Deinococcus proteolyticus MRP]
Sequence
MRRGLGLAALLLAGSASAADLTLRPQGPDLTRAVQQALAELSTPGLPLRLVTTGGPALTL
GSSSGVPFNPDVAVRTVGQGAQRRIEINPQGPLTLNVAVRQALAQEFELDAWTPEAARLR
FSGADLNGDGAVDLTDLALLMSNLGGSGRGDLNGDRQVDDADLKLFAEAYQLP
Download sequence
Identical sequences F0RNM3
gi|325283425|ref|YP_004255966.1| WP_013614958.1.93574

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]