SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|325284762|ref|YP_004264225.1| from Deinococcus proteolyticus MRP

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|325284762|ref|YP_004264225.1|
Domain Number 1 Region: 148-403
Classification Level Classification E-value
Superfamily Subtilisin-like 3.4e-77
Family Subtilases 0.00000436
Further Details:      
 
Domain Number 2 Region: 65-144
Classification Level Classification E-value
Superfamily Protease propeptides/inhibitors 0.00000000000561
Family Subtilase propeptides/inhibitors 0.0034
Further Details:      
 
Domain Number 3 Region: 462-531
Classification Level Classification E-value
Superfamily Collagen-binding domain 0.000000772
Family Collagen-binding domain 0.0081
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|325284762|ref|YP_004264225.1|
Sequence length 532
Comment Aqualysin 1 [Deinococcus proteolyticus MRP]
Sequence
MKKTTFVALGLGLLLASCGNAPSAPSTPAAPAPEAGQGLTQVPNPERARSAGELAPLIEV
DQKNVIDGQYIVVLSEGALGSDLSAQSESSLIQAFGLQPQGVTMQYIYGQALEGFAAQLS
AENLQILRADPRVKYIEQDQVMRANATQSGATWGLDRVDQRTLPLNGTYVYNTNASNVTS
YIIDTGILTTHNDFGGRAVWGTNQTGDGRNTDCNGHGTHVAGTVGGSTYGVAKATRLVAV
KVLGCDGSGSNSGVIAGINWAASNRSGPAVANMSLGGGASQATDDAVSGAVNRGLTMVVA
AGNENQNACNVSPARAPLAITVGATTRSDARSSFSNYGSCVDINAPGSDITSAWYTGNSA
TNTISGTSMASPHVAGGAALVLSTNPSYTPAQVASTLNANATTGQLTGLNGSPNRLLYTL
AGTGTTPTPTPTPTPAPGERTFTGTVSQGNSLYAPSASGEARSGTITLQLTGPSGTDFDL
FLQRWNGSSWVDVASSESTGSSERISTSVTSGTYRYEVYAYSGSGSFTLTVQ
Download sequence
Identical sequences F0RPQ9
gi|325284762|ref|YP_004264225.1|NC_015169 WP_013623097.1.93574 gi|325284762|ref|YP_004264225.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]