SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15679048|ref|NP_276165.1| from Methanothermobacter thermautotrophicus str. Delta H

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15679048|ref|NP_276165.1|
Domain Number 1 Region: 6-157
Classification Level Classification E-value
Superfamily Sortase 2.22e-24
Family Sortase 0.0093
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15679048|ref|NP_276165.1|
Sequence length 240
Comment hypothetical protein MTH1030 [Methanothermobacter thermautotrophicus str. Delta H]
Sequence
MRASTLLIIAGMFIVSLYALIEVSFYSSQVTVHRPDVRAPVIEVPSINLTETINNRSVFY
GVYHEPMSYPPGNRTVILFGHRTLYGSPFLHLDKLRAGDSVYLNWPGVGFAEYRVNRSFI
VPASYQMPVNQGAKLFLITCHPLGSTRERLIVECHLEGIRPYQRNVRVDNPKSYYSIPII
LGFLSAGLLVTRFYPVEEDRRFLLAAVIGLTVFLVLGYLFPIPPEFISDKLMEFNNILGI
Download sequence
Identical sequences O27109
GO.11090 WP_010876661.1.22989 gi|15679048|ref|NP_276165.1| 187420.MTH1030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]