SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15679141|ref|NP_276258.1| from Methanothermobacter thermautotrophicus str. Delta H

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15679141|ref|NP_276258.1|
Domain Number 1 Region: 2-251
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 1.61e-127
Family Methyl-coenzyme M reductase gamma chain 0.000000025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|15679141|ref|NP_276258.1|
Sequence length 265
Comment methyl coenzyme M reductase II subunit gamma [Methanothermobacter thermautotrophicus str. Delta H]
Sequence
MSYKAQYTPGETQIAENRRKHMDPDYEFRKLREVSDEDLVKVLGHRNPGESYKSVHPPLD
EMDFEEDIVRDMVEPIQGAKEGVRVRYIQFADSMYNAPAQPYDRARTYMWRYRGVDTGTL
SGRQVIEMRELDLEGVSKELVETELFDPATTGIRGATVHGHSLRLDENGLMFDALQRYVF
DEEKGHVVYVKDQVGRPLDEPVDMGQPLGEDELKKITTIYRKDNIAMRDDKEAIEVVENI
HTGRTMGGFGMDVFKDDLRKRLGDD
Download sequence
Identical sequences A0A223ZG87 T2GI75
187420.MTH1130 WP_010876754.1.101079 WP_010876754.1.22989 gi|15679141|ref|NP_276258.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]