SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|15679176|ref|NP_276293.1| from Methanothermobacter thermautotrophicus str. Delta H

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|15679176|ref|NP_276293.1|
Domain Number 1 Region: 6-252
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 7.85e-126
Family Methyl-coenzyme M reductase gamma chain 0.000000000303
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|15679176|ref|NP_276293.1|
Sequence length 252
Comment methyl coenzyme M reductase I subunit gamma [Methanothermobacter thermautotrophicus str. Delta H]
Sequence
MHDMAQYYPGTSKVAQNRRNFCNPEYELEKLREISDEDVVKILGHRAPGEEYPSVHPPLE
EMDEPEDAIREMVEPIDGAKAGDRVRYIQFTDSMYFAPAQPYVRSRAYLCRYRGADAGTL
SGRQIIETRERDLEKISKELLETEFFDPARSGVRGKSVHGHSLRLDEDGMMFDMLRRQIY
NKDTGRVEMVKNQIGDELDEPVDLGEPLDEETLMNKTTIYRVDGEAYRDDTDAVEIMQRI
HVLRSQGGYNPE
Download sequence
Identical sequences 187420.MTH1165 gi|15679176|ref|NP_276293.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]