SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|333922435|ref|YP_004496015.1| from Desulfotomaculum carboxydivorans CO-1-SRB

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|333922435|ref|YP_004496015.1|
Domain Number 1 Region: 3-111
Classification Level Classification E-value
Superfamily N-utilization substance G protein NusG, N-terminal domain 7.72e-45
Family N-utilization substance G protein NusG, N-terminal domain 0.0000252
Further Details:      
 
Domain Number 2 Region: 119-173
Classification Level Classification E-value
Superfamily Translation proteins SH3-like domain 4.61e-19
Family N-utilization substance G protein NusG, C-terminal domain 0.00087
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|333922435|ref|YP_004496015.1|
Sequence length 175
Comment NusG antitermination factor [Desulfotomaculum carboxydivorans CO-1-SRB]
Sequence
MSKQWYVVHTYSGYENKVKANLERRIESMNMEDKIFRILVPMEDEVEIKNGKKKVSKKKV
FPGYVLVEMIMTDDSWYVVRNTPGVTGFVGSGTKPIPLNEDEAKAIIKQMGMEEPRTRVD
YSLGENVRVTDGPFENFVGVIEEIYPDKGKVKVMVSMFGRETPIELDFTQIEKMS
Download sequence
Identical sequences F6B584
gi|333922435|ref|YP_004496015.1| WP_003545482.1.79281 WP_003545482.1.92302

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]