SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|379022737|ref|YP_005299398.1| from Rickettsia canadensis str. CA410

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|379022737|ref|YP_005299398.1|
Domain Number 1 Region: 7-38
Classification Level Classification E-value
Superfamily Sec7 domain 0.0000379
Family Sec7 domain 0.006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|379022737|ref|YP_005299398.1|
Sequence length 53
Comment hypothetical protein RCA_01695 [Rickettsia canadensis str. CA410]
Sequence
MTRYLDNYLKNFNFPQDVEKITKLVEAFSNNYYKYKNPKENKQILEEIYNIRK
Download sequence
Identical sequences gi|379022737|ref|YP_005299398.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]