SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|323356642|ref|YP_004223038.1| from Microbacterium testaceum StLB037

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|323356642|ref|YP_004223038.1|
Domain Number 1 Region: 122-612
Classification Level Classification E-value
Superfamily Amidase signature (AS) enzymes 1.3e-107
Family Amidase signature (AS) enzymes 0.000000168
Further Details:      
 
Domain Number 2 Region: 56-116
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.00000366
Family Type I dockerin domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|323356642|ref|YP_004223038.1|
Sequence length 621
Comment Asp-tRNAAsn/Glu-tRNAGln amidotransferase A subunit [Microbacterium testaceum StLB037]
Sequence
MNAPRSAPATAAVKGTPVRRTTIGTVVTALTAAALVFGTVVPAHADTDSVSYLAPAYQRG
ELTGDAKVDRDDLSVLMSAVGRKVGDPGWDAVAPADADQDGVITVADVAALSKRFVYDDD
PFDLQETDVVAIQKAMTAGVLTSQELTAQYLRRIAAYDRTTGLDPFEPDAALASIIATNP
TAMAEAAALDAERAATGPRSILHGIPIIAKDNINLAGLATTAGCGCLADNVTSTDADAIE
RLKAMGAIVIAKANLSEFAQHTTVSDSAYGSTRNPFGLALPPGGSSGGTGASISANLGVV
GLGTDTGGSIRVPASTNGLVGLRPTTGLVSREGVIPLDEYRDTIGPMTRNVSDAALALDA
LAGTDPADPMTAPADAHKPVSYAQALDPEALRGARVGYLSGFGWDEKQPGSLALVTEARA
DLETAGATVVDIGEYGIGLDGVHGSRSFAHDMDMYLDTFYKPGYTFLDLAQKIIDAEKAG
TPLSSFPGETVREWASTTAAEREKFTADFLVLQRSMRDRVDQLMAENDLDAIVYPSTSGT
VGTAGSNNIISAFTGYPAITVPMGLAPLPPEAPAYAGFPEGLEFLAGPYAEEKLFGLAYA
FEQRTHHRQEPPLFPDLPPAP
Download sequence
Identical sequences E8N8U9
WP_013583285.1.25428 gi|323356642|ref|YP_004223038.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]