SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|323359723|ref|YP_004226119.1| from Microbacterium testaceum StLB037

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|323359723|ref|YP_004226119.1|
Domain Number 1 Region: 57-92,178-274
Classification Level Classification E-value
Superfamily Elongation factor Ts (EF-Ts), dimerisation domain 9e-38
Family Elongation factor Ts (EF-Ts), dimerisation domain 0.00022
Further Details:      
 
Domain Number 2 Region: 3-56
Classification Level Classification E-value
Superfamily UBA-like 0.000000000000124
Family TS-N domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|323359723|ref|YP_004226119.1|
Sequence length 275
Comment translation elongation factor Ts [Microbacterium testaceum StLB037]
Sequence
MANFTIADIKALREQLGTGMVDTKKALEEADGDVEKAVEILRLKGAKGNAKRADRSTSEG
LVVARENNGSVTLLELACETDFVAKNERFIALADKVVDAAAAAGADSVEAALAADADGKT
VEQLISDEAAIIGEKVELRRVRTISGDKFEVYLHKTSKDLPPQVGVVLAYTGDDAETARS
IAQHISFANPSYLTRDAVPEADVEKEREIVTEISRNEGKPEAALPKIVEGRVNAFFKQVA
LLDQDYAKDNKLSVAKVASDAGLTLTDFARFKVGA
Download sequence
Identical sequences E8NDH3
gi|323359723|ref|YP_004226119.1| WP_013586361.1.25428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]