SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|323360038|ref|YP_004226434.1| from Microbacterium testaceum StLB037

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|323360038|ref|YP_004226434.1|
Domain Number 1 Region: 5-256
Classification Level Classification E-value
Superfamily Cgl1923-like 7.45e-66
Family Cgl1923-like 0.00074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|323360038|ref|YP_004226434.1|
Sequence length 288
Comment hypothetical protein MTES_3590 [Microbacterium testaceum StLB037]
Sequence
MDALGRRIIVAAFDGWNDAGEAASAAAALLRADTEYEVVHAVDPELYFDYQYTRPQIGLD
AEGHRTLTWPEARLLRPTQRSDDAEIWLLVGVEPARAWQAFAAEFIDVALREDVTGFVAL
GSMMSDVPHTRPISVFAGSDNEGVRQALDLERSLYEGPVGILSAIGHAAEGVGIPTASLW
ASVPHYVAGHTPSPKATLALLDRLQSLTGIEVPRGELAAEAVAWEASIDAAAADDEEMSD
YIRQLEQTRDTWDSPEASGDAIAQEFERYLRRGGDGPSKPGRDDPPRR
Download sequence
Identical sequences E8NG83
gi|323360038|ref|YP_004226434.1| WP_013586676.1.25428

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]