SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|307352473|ref|YP_003893524.1| from Methanoplanus petrolearius DSM 11571

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|307352473|ref|YP_003893524.1|
Domain Number - Region: 144-219
Classification Level Classification E-value
Superfamily Transglutaminase, two C-terminal domains 0.0698
Family Transglutaminase, two C-terminal domains 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|307352473|ref|YP_003893524.1|
Sequence length 390
Comment hypothetical protein Mpet_0312 [Methanoplanus petrolearius DSM 11571]
Sequence
MKSGIIILLILTAFLATAASAASTSTNDAASYIEITSYEVSPSVFMKGDTGTIQVTIKNT
GTSSVEIQSADLFSKDLTLVNEESYSTVGTVGPGTSRDFTFTIKADASDGIYYPRFYINF
AGGGSMSGLIPVKVESTPLEISIIDIPDEFGKDVKDPVTVLVGNPRENAVNGVVVKPESD
TASFIQNSYFIGELQSDGSQQVEFEVIPLESGKIVFNVEYRNGINLHTTEQVLTYTIGEG
KMDAEIVVNNVEVSSGSSYYTVTGDVTNAGLKNAKSVIVTSSDPAVPTDPNRLYVVGELE
PDDFSSFEVTFTAENTKEIPLSIIYKDEDGNSYEEKVTVSLGASYSQSSGQSSQDSSGDG
FPVGLVILVIIIAAGVGGAILYSWKKEGRL
Download sequence
Identical sequences E1RFT4
gi|307352473|ref|YP_003893524.1| WP_013328265.1.58734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]