SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|307352557|ref|YP_003893608.1| from Methanoplanus petrolearius DSM 11571

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|307352557|ref|YP_003893608.1|
Domain Number - Region: 553-647
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0214
Family I set domains 0.07
Further Details:      
 
Domain Number - Region: 106-138
Classification Level Classification E-value
Superfamily SurE-like 0.0693
Family SurE-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|307352557|ref|YP_003893608.1|
Sequence length 879
Comment hypothetical protein Mpet_0396 [Methanoplanus petrolearius DSM 11571]
Sequence
MTKKFALALVSLMVLAFIVVGSASAAPAYATNITPGQTIFIGESGLNIALALGADADGTT
PISKIAWFSSGTAVASEQPAIVYSVGDNSSFYVQNAMFSAYEGSWYGYNGSIGSATLAFY
VYKPSLAVSIWDIGTDGSATDVTGKKVTTGDNVTLRVDSNLFSLFERPSNVSSQALNGID
INVVTPSGATLVKLTNSSATNFTTNITGIRPTSSQYYLLTSSAKPLNGTATPWQLNISQY
SAGTYEVTAKCNINGMKDNLGSITGVTVSETATLELDKDTVSITADKETVVRNNDFSVTI
DGKPSTYYYVWMSGTNSYTYGNGSGDADTADIPPQFQINQDDVDFLSNNISSGDNTGLNY
TYKSGTRIYQDVANNASYTAATSNLNPYAVEVKTGKDGMITVGITTGSNTKAATYTVRVE
SESDTQLYDTVKVTVEKGSVTITASGDGSYYLGEQITFSGTDTDSDYVYLFITGPNLAEN
GANLETPSIALENGNASTFVTKAVNVDNTWEYKLETSTIGLDAGTYTVYAVNEPADKAHL
SGTKYDTVSIVVKKPFVTATVSASTVAKGDKLYIRGTAEGNPTQGVAIWILGKNYWNGEA
TNSDAMVTETVNDDGSFEYEFGSGDTKNLASGQYFVVVQHPMYNDEFNVFTGGVSPTFVI
ESPDRSAYATNNNEYNARFVIWGGDNKLQGSDAAEALIEMIDSADIDDTYTKLTFLVEEP
WIRINTVGDHYVGDQFTISGTTNLAVDDDLIVEVTSSSFTATQKSQSGEFSGQSETVKVV
AGTTYNEWSMDVDASTFKADEYIVNVESIETSATATTTFNILTPGPSTPTVTSTATSGPV
TTTATTTQATPTETAAPGFGALVALIGLGAVAALVLRKE
Download sequence
Identical sequences E1RGF9
WP_013328348.1.58734 gi|307352557|ref|YP_003893608.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]