SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|307353009|ref|YP_003894060.1| from Methanoplanus petrolearius DSM 11571

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307353009|ref|YP_003894060.1|
Domain Number 1 Region: 4-245
Classification Level Classification E-value
Superfamily Aquaporin-like 4.71e-61
Family Aquaporin-like 0.0000424
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|307353009|ref|YP_003894060.1|
Sequence length 254
Comment MIP family channel protein [Methanoplanus petrolearius DSM 11571]
Sequence
MVSLFKRSVAELIGTLLLVYFGAGAAAMTLMLVEGEETPNVFNIGIGLLGGLGDWLAIGL
AFGITVMAVIYMFGRVSGAHINPAVSIGLWVKGLFPTKDMVAYVVAQFIGALAGSILFAL
SVGPEAITVGGLGATAPFTGITVWEALLAEIIGTFLLMTIIMGAAVDEKAPPGFAGLAIG
LTVAGIITTIGNISGASINPARSFGPMIADLLFGGPNVVGVYWIYVAGPIIGAVLAVFLY
SWIVKEDEPAGKAA
Download sequence
Identical sequences E1RJA4
WP_013328800.1.58734 gi|307353009|ref|YP_003894060.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]