SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|307353088|ref|YP_003894139.1| from Methanoplanus petrolearius DSM 11571

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307353088|ref|YP_003894139.1|
Domain Number 1 Region: 6-137
Classification Level Classification E-value
Superfamily NTF2-like 1.43e-30
Family SnoaL-like polyketide cyclase 0.0022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|307353088|ref|YP_003894139.1|
Sequence length 149
Comment hypothetical protein Mpet_0934 [Methanoplanus petrolearius DSM 11571]
Sequence
MSTEVNRAIVRRFIYAYNTRNLDLFNELVAPGYVDHTHGKKGIEEFRKLFELAFVAFPDW
HEEIVDMIAEEDKVWVRVEATGTQTGEWKYMGGSLSPTGNKITMTMVFIWRIAGGKLAEG
WEVDSDSDFLNKLGLMDYTEKGKEMFSGE
Download sequence
Identical sequences E1RJQ4
WP_013328879.1.58734 gi|307353088|ref|YP_003894139.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]