SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|307353096|ref|YP_003894147.1| from Methanoplanus petrolearius DSM 11571

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307353096|ref|YP_003894147.1|
Domain Number 1 Region: 31-147
Classification Level Classification E-value
Superfamily Carbohydrate-binding domain 0.0000153
Family Cellulose-binding domain family III 0.022
Further Details:      
 
Domain Number 2 Region: 262-315
Classification Level Classification E-value
Superfamily Type I dockerin domain 0.0000255
Family Type I dockerin domain 0.0085
Further Details:      
 
Domain Number 3 Region: 153-239
Classification Level Classification E-value
Superfamily E set domains 0.0000665
Family E-set domains of sugar-utilizing enzymes 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|307353096|ref|YP_003894147.1|
Sequence length 317
Comment peptidase C1A papain [Methanoplanus petrolearius DSM 11571]
Sequence
MITTVMMLLLIVTPVIATNATVFIDCGNISEIGDSTTIYLTLDNAPQGLSGYNLNVSLDN
TSIAEITGVSFPDWAANMSTHGALPAGSGLLIKASDVNYLVEPGATSITLATLTLKGLRP
GSTEITMANANFDDDNGSDIPHYVSTGTLSVDYTPAIFNITPDSGYNNGSVNFMLNGSWL
MSGASVNLTRGDSSIPAVNLSYVSETQIDGIFDINGLDEGRWNVTVTNPDGKKATLTDGF
TIIMSMAPVNGVMPTDPNGDGIYEDLNGNAQADYADVNIFFVSYSWIEGNEPEDAFDFNN
NGRLDMADIVVLFDSIS
Download sequence
Identical sequences E1RJR2
WP_013328887.1.58734 gi|307353096|ref|YP_003894147.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]