SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|307353108|ref|YP_003894159.1| from Methanoplanus petrolearius DSM 11571

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307353108|ref|YP_003894159.1|
Domain Number 1 Region: 4-111
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.02e-24
Family Anti-sigma factor antagonist SpoIIaa 0.00097
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|307353108|ref|YP_003894159.1|
Sequence length 115
Comment anti-sigma-factor antagonist [Methanoplanus petrolearius DSM 11571]
Sequence
MNIMEINRKKSEPAEIIMVKGRIDAQNSSILDENLKEAIKSGSGKIIINMNEVDYISSSG
LRVMLSALKTVRLSGGDIKLSGLKPFVMDVFVVSGFNSIFDIHGSENEALSDFIK
Download sequence
Identical sequences E1RJS4
gi|307353108|ref|YP_003894159.1| WP_013328899.1.58734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]