SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|307353314|ref|YP_003894365.1| from Methanoplanus petrolearius DSM 11571

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307353314|ref|YP_003894365.1|
Domain Number 1 Region: 3-86
Classification Level Classification E-value
Superfamily RNA-binding domain, RBD 5.64e-31
Family Canonical RBD 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|307353314|ref|YP_003894365.1|
Sequence length 87
Comment RNP-1 like RNA-binding protein [Methanoplanus petrolearius DSM 11571]
Sequence
METSKLYVGNLTYSVTEKQLEELFSQYGDVKSVRIIERKGFGFVEMGSAEEAEKAMAALN
ETEYEGRTMRIDEARPPRPRSDFNRRY
Download sequence
Identical sequences E1RD27
WP_013329105.1.26624 WP_013329105.1.58734 gi|307353314|ref|YP_003894365.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]