SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|307353765|ref|YP_003894816.1| from Methanoplanus petrolearius DSM 11571

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307353765|ref|YP_003894816.1|
Domain Number 1 Region: 4-116
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.69e-20
Family Sfri0576-like 0.0038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|307353765|ref|YP_003894816.1|
Sequence length 119
Comment UspA domain-containing protein [Methanoplanus petrolearius DSM 11571]
Sequence
MPESSGKNTGFLIRGKLTDEDYRKTLIPVLEKALEEHERINIMFKTENFEGRTAHAAWDD
FINWPKIAAVNETAVVFDEKWDEFMSWLFKSYAFISHIYMKFFKEDRIDEAWEWLRSGK
Download sequence
Identical sequences E1RH74
WP_013329555.1.58734 gi|307353765|ref|YP_003894816.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]