SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|307354102|ref|YP_003895153.1| from Methanoplanus petrolearius DSM 11571

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  gi|307354102|ref|YP_003895153.1|
Domain Number - Region: 26-205
Classification Level Classification E-value
Superfamily PhoU-like 0.000174
Family PhoU-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|307354102|ref|YP_003895153.1|
Sequence length 214
Comment hypothetical protein Mpet_1965 [Methanoplanus petrolearius DSM 11571]
Sequence
MTGKSKVTAKIKILDNIFPPEYDFKGMLEEQAESTQKGVGTFVFWLRDVPLKDPRNIDKI
AAEVDDLRHNLEQKMVEAFSTPFDRQDMYTLSRHMDYILNHTKETAREMYSFGVSPDEAI
INMAEQIFRGTGLMVDAVRAMNNEESKVEEYIRMARKSMHEIDDTYIESMAELLHTEDPM
NALRKGEIYHHLREIERALRRAVDLLHKAFLGMN
Download sequence
Identical sequences E1RJ45
WP_013329892.1.58734 gi|307354102|ref|YP_003895153.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]