SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|307354293|ref|YP_003895344.1| from Methanoplanus petrolearius DSM 11571

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307354293|ref|YP_003895344.1|
Domain Number 1 Region: 145-238
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000894
Family I set domains 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|307354293|ref|YP_003895344.1|
Sequence length 337
Comment hypothetical protein Mpet_2158 [Methanoplanus petrolearius DSM 11571]
Sequence
MNSKIISLLIISAAIFCVICPVQADAGQSEQITITASGDRSYYSDEMITFSGTNTGSDYV
YLFITGPNLNENGSRPDEPGTAAGTGNVNTFSRAAVADNDTWKYKLFNATDFEPGTYTVF
AVTEPNNMKDLSKGTYDSVSIAIKKPFITVQVSEPVVQRGEELVITGSASWMPHSVAIWV
LGFNYWNGAENGSMVTVIPEDDGSYSYVLDGNETAKMEDGKYYVIAQHPMYNDEFNVIIE
DDSSGDGVLVTGIRTDSPEENGSGFYIGGNYALRGADAAEALIEEIDSADIDDTYDKCEF
EIKGQVENGQSGNNQPDKNTDNSILAAIGNLFVGISG
Download sequence
Identical sequences E1RK93
gi|307354293|ref|YP_003895344.1| WP_013330083.1.58734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]