SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|307354552|ref|YP_003895603.1| from Methanoplanus petrolearius DSM 11571

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307354552|ref|YP_003895603.1|
Domain Number 1 Region: 187-434
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 7.06e-116
Family Methyl-coenzyme M reductase alpha and beta chain C-terminal domain 0.0000000252
Further Details:      
 
Domain Number 2 Region: 3-186
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 4.32e-64
Family Methyl-coenzyme M reductase alpha and beta chain N-terminal domain 0.00000532
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|307354552|ref|YP_003895603.1|
Sequence length 434
Comment methyl-coenzyme M reductase subunit beta [Methanoplanus petrolearius DSM 11571]
Sequence
MAKYSETIDLYSDDGKVLKSNVNLGAISPLVNPATLKLIDLTKRSIAVNLGGIEAALKTG
KLGKGGMIMGRELDLPIMANKDAIVAKIKDMLDVEGEGTVINEYKGGNLLLVEAPKARLA
AASTYDAAFTAVAAATTYAIVDQFDIDAFNASTVKAATFGGYPHTMDPEGALVTSVLSNP
QNNEGLGYALRNIGVNHFVMMTGRNAMQGAALAATLETAGEFEMGGAIGPFERHMLLQYA
YQGLNANNMVYDLVKENGKTGTVGTVVQSLVEKAIEDKVIVPGKKGGYFQFYDTKDPMMW
NAYAAAGTMAATMVNCGAGRFAQAVSSTLLYFNDLLEHETGLPSTDFGRVMGTAVGFSFF
SHSIYGGGGPGIFNGNHVVTRHANGCAIPCVVAACALDAGTQMFTPEGTSAVMGQTYGQI
PEFNKPIQQIANGV
Download sequence
Identical sequences E1RDX8
WP_013330342.1.58734 gi|307354552|ref|YP_003895603.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]