SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|307354129|ref|YP_003895180.1| from Methanoplanus petrolearius DSM 11571

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|307354129|ref|YP_003895180.1|
Domain Number 1 Region: 4-250
Classification Level Classification E-value
Superfamily Methyl-coenzyme M reductase subunits 1.1e-117
Family Methyl-coenzyme M reductase gamma chain 0.0000000549
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|307354129|ref|YP_003895180.1|
Sequence length 254
Comment methyl-coenzyme M reductase subunit gamma [Methanoplanus petrolearius DSM 11571]
Sequence
MYKPQYGPGTSVVAQNRRNQMNPEYELSKIRSVTDEDIILILGHRAPGQAYPSAHPPLAE
QQEPDDPMRKLVKPTEGAKAGDRVRYIQFADSMFNAPCQPYQRTYMEMYRFRAIDPGTLS
GRQIVECRERDLEQYSKILIETEVFDPATVSCRGATVHGHSLRLAEDGLMFDALQRCILA
EDGNVCYVKDQIGIPLDRPVYVGKPMDEEWLREKSTIFHSLVGTALRDDKEYVKYIQRIH
SLRTKYGFMPTEEE
Download sequence
Identical sequences E1RJD6
WP_013329919.1.58734 gi|307354129|ref|YP_003895180.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]