SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|332292367|ref|YP_004430976.1| from Krokinobacter sp. 4H-3-7-5

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|332292367|ref|YP_004430976.1|
Domain Number 1 Region: 11-141
Classification Level Classification E-value
Superfamily Cytochrome c 0.0000000000108
Family monodomain cytochrome c 0.025
Further Details:      
 
Weak hits

Sequence:  gi|332292367|ref|YP_004430976.1|
Domain Number - Region: 278-329
Classification Level Classification E-value
Superfamily Multiheme cytochromes 0.0237
Family Di-heme elbow motif 0.038
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|332292367|ref|YP_004430976.1|
Sequence length 338
Comment hypothetical protein Krodi_1725 [Krokinobacter sp. 4H-3-7-5]
Sequence
MKPSLFYLPLVFTLILLTSCNESQKTTYVSQSGVTPELDKITTAVNHPGKKLMESKCYAC
HNPSTGHEGRIAPPMVAVKSHYMNDDTTKEEFIAAVWNFVQKPSKETSKMRGAVKRFDLM
PYQPFPQEEIELIADYMYDYKIDEPAWFKEHVEEESKGKMQYRNDGKIDDTLASFQTENK
ADIGLRYALQTKQELGKNLMGTIQKKGTLEAVSFCNKKAYPITDSMAVVQNATIRRVSDK
PRNPANQASQKELSIITHFKKVIASDEDYEPVTELVDDKVNFYYPITTNSMCLQCHGTPT
IDIEPAVLSSIKNLYPTDKAVGYNVNEVRGIWSISYEN
Download sequence
Identical sequences F4AW30
gi|332292367|ref|YP_004430976.1| WP_013751216.1.5237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]