SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|340617247|ref|YP_004735700.1| from Zobellia galactanivorans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340617247|ref|YP_004735700.1|
Domain Number 1 Region: 5-70
Classification Level Classification E-value
Superfamily PHP domain-like 0.0000000175
Family PHP domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|340617247|ref|YP_004735700.1|
Sequence length 992
Comment DNA polymerase III subunit alpha [Zobellia galactanivorans]
Sequence
MYLNCHTYYSLRYGTLKPEELLALAAENNNGVLALTDINNTSACLDFVRLAPNYGIKPVL
GVDFRNGVDQQFVILAKNNDGFRRINAYLSSFLHRPGAIIPESPIEMEDCFVIYPFEKGK
DRILNKNEYLGVAPKKLRHLKFSKSTFETDKLVLLHTVSFRDKRGFNTHRLLRAIDNNTL
LSKLPEHEQGSETDRFLTAEARERIAVDFPELTENTKRLLDSCHIKFDFSKTTPNNQRSY
TQNEELDFRLLQKLAYQGIPYRYKKVDETIYSRVSKELNIIKEKGFVSYFLINWKILKYA
RSKGYFYVGRGSGANSIIAYLLRITDVDPIELDLYFERFINLYRQNPPDFDIDFSWSDRD
DITRFMFERFKNTALITVYNTFKFRASVRELGKVFGLPKSEIDILSKGKYDINQLDRLSQ
LVIKYSRYIQGFPNYLGIHAGGVLISEKPIHHYCATFMPPKGFATTQIDMVVAEDIGLYK
FDILSQRGLGKIKDAVEIITKNHRNIKSIDIHDIKRFKEDQRIKHLLKNAKAIGCFYVES
PAMRMLLKKLQVDNYLGLVAASSVIRPGVAKSGMMREYILRYRYPERRKEAHPVLLHIMP
ETFGVMVYQEDVIKVAHHFGGLTLGEADMLRRGMSGKFRSRDEFLKVKQRFFDNCKADGK
PDAVTRDIWRQIESFAGYAFAKGHSASYAVESYQSLFLKAYYPIEYMVATLNNGGGFYNR
ELYIHEAKMHGALIEAPCINHSEYLTRVQGKKIYLGFSLLKDLETRTVEKILADRAQHGT
YKNLDDFIDRVSISTEQMAILIKINAFRFTGSNKRELLWSAYLQTSKIPKEEHVNTLFRS
EKISYKTPELKSSELENAFDEYELLGFPLCNPFDLLASPKKNALRVSELLSYKGKIVTIE
GYLVATKNTATSNGKPMYFGTFLDRSGDFIDTVHFPPVAAKFPFRGKGIYSITGKVTEEF
ECVNIEVTTMYRQAIIEDPRYSDNHNTTLSHV
Download sequence
Identical sequences G0L3A1
gi|340617247|ref|YP_004735700.1| WP_013992621.1.951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]