SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|340618352|ref|YP_004736805.1| from Zobellia galactanivorans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340618352|ref|YP_004736805.1|
Domain Number 1 Region: 23-252
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.64e-53
Family Extended AAA-ATPase domain 0.000000601
Further Details:      
 
Domain Number 2 Region: 260-329
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 4.99e-24
Family Helicase DNA-binding domain 0.0004
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|340618352|ref|YP_004736805.1|
Sequence length 340
Comment Holliday junction DNA helicase [Zobellia galactanivorans]
Sequence
MNEYLDPVGENFTPEEFDIERALRPISFDDFTGQEQVLENLKVFVEAANQRGEALDHTLF
HGPPGLGKTTLAHILANELGVGIKITSGPVLDKPGDLAGLLTNLEERDVLFIDEIHRLSP
IVEEYLYSAMEDYKIDIMIETGPNARSVQINLNPFTLIGATTRSGLLTSPMRARFGIQSR
LQYYSTELLSTIVERSAEILKVPISQEAAIEIAGRSRGTPRICNALLRRVRDFAQIKGNG
TIDMEISKFSLKALNVDAHGLDEMDNKILSTIIDKFKGGPVGITTLATAVSESAETIEEV
YEPFLIQQGFIMRTPRGREVTDLAYKHLGKLKGGVQPGLF
Download sequence
Identical sequences G0LBZ6
WP_013993724.1.951 gi|340618352|ref|YP_004736805.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]