SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|340618691|ref|YP_004737144.1| from Zobellia galactanivorans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340618691|ref|YP_004737144.1|
Domain Number 1 Region: 39-261
Classification Level Classification E-value
Superfamily PHP domain-like 1.45e-34
Family PHP domain 0.0023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|340618691|ref|YP_004737144.1|
Sequence length 370
Comment hypothetical protein zobellia_2715 [Zobellia galactanivorans]
Sequence
MKKRALVILLIIFQQSYSQTHSHAGAKPMSYPDIEGYKTLKTDLHQHTVFSDGKVWPTIR
VQEALRENLDAISLTEHLEYQPHKEDIPHPDRNRSYALALAEAKSHNLLIVHGSEITRSA
PVGHNNAIFIKDANQLNVDKAEKAFSEAKKQGAFVFWNHPAWYAQSPKGTPILSDFQEKR
IKKGELHGIEVINTVDYSEEALTLALENDLTIMGTSDIHGLIDWDYTEKGNHRPITLVFA
EDKTMEGLKEALFAGRTVAVYNDLMVGKAEYLKPLLQKSIAIGKAEYRSKSQVLELQLKN
ISSSDLLFENQMEYSFYDSSPVFEIPAGETKRLLVKTLDTKTEIVLKLKALGCFTAPRQQ
PIIEWKIVID
Download sequence
Identical sequences G0L6D7
WP_013994061.1.951 gi|340618691|ref|YP_004737144.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]