SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|340619751|ref|YP_004738204.1| from Zobellia galactanivorans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340619751|ref|YP_004738204.1|
Domain Number 1 Region: 18-239
Classification Level Classification E-value
Superfamily PHP domain-like 2.35e-18
Family PHP domain 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|340619751|ref|YP_004738204.1|
Sequence length 246
Comment tyrosine-protein phosphatase [Zobellia galactanivorans]
Sequence
MFHFFSKKKFLSDYLEGFIDIHNHILPGIDDGAKTVDESIGLIKAFSELGVKHFIATPHI
MSNYYPNTKETIQAALSELKNALLQNGLTDISIEASAEHMIDDNYEFLLESSGVMPMKKD
YLLVEMSYLQPPINFDDAIIKTASNRFFPILAHPERYGFLHHRMKRYNQYKDNGILFQMN
LLSLSEYYGKEVPKVAHELLENGFIDFLGSDIHNMNQFNALKKLTVSKKTLEQLLPLINN
TIETFY
Download sequence
Identical sequences G0L1V5
gi|340619751|ref|YP_004738204.1| WP_013995115.1.92583 WP_013995115.1.951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]