SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|340620721|ref|YP_004739174.1| from Zobellia galactanivorans

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|340620721|ref|YP_004739174.1|
Domain Number 1 Region: 1-195
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 4.78e-37
Family Nucleotide and nucleoside kinases 0.00028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|340620721|ref|YP_004739174.1|
Sequence length 196
Comment dephospho-CoA kinase [Zobellia galactanivorans]
Sequence
MRIVGLTGGIGSGKTTVAKMFEELGVPVYNSDTRAKELMQSSQDLVLAIKELLGEEAYRE
DGVLDRGFVSRQVFDNKALLNELNAIVHPAVRKDFIHWADEQTADYVIQEAAIIFEIGTQ
DFYDCIILVVAPKETRIERVVQRDAGTTVKSVEARMKNQWEDDRKIEASDYVIENTNLEQ
TKVQVLDIHRDLLNKI
Download sequence
Identical sequences G0L4T7
gi|340620721|ref|YP_004739174.1| WP_013996082.1.951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]